PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G10113.1
Common NameRVE7L, T22K18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 336aa    MW: 37605.1 Da    PI: 7.4989
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G10113.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-1765109147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +W++eE++++++a+k++G g W+ I +++g ++t+ q++s+ qk+
      AT3G10113.1  65 REKWSEEEHDRFLEAIKLYGRG-WRQIQEHIG-TKTAVQIRSHAQKF 109
                      789*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.36E-1659113IPR009057Homeodomain-like
PROSITE profilePS5129419.76860114IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.0E-1061112IPR009057Homeodomain-like
TIGRFAMsTIGR015576.5E-1663112IPR006447Myb domain, plants
SMARTSM007175.2E-1364112IPR001005SANT/Myb domain
PfamPF002495.5E-1565108IPR001005SANT/Myb domain
CDDcd001675.29E-1167110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MVMMIIIYTE PEISLFPLQD RSEELSSNVE NGSCNSNEGI NPETSSHWIE NVVKVRKPYT  60
VTKQREKWSE EEHDRFLEAI KLYGRGWRQI QEHIGTKTAV QIRSHAQKFF SKMAQEADSR  120
SEGSVKAIVI PPPRPKRKPA HPYPRKSPVP YTQSPPPNLS AMEKGTKSPT SVLSSFGSED  180
QNNYTTSKQP FKDDSDIGST PISSITLFGK IVLVAEESHK PSSYNDDDLK QMTCQENHYS  240
GMLVDTNLSL GVWETFCTGS NAFGSVTEAS ENLEKSAEPI SSSWKRLSSL EKQGSCNPVN  300
ASGFRPYKRC LSEREVTSSL TLVASDEKKS QRARIC
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO223309450.0
Genevisible261663_at0.0
Expression AtlasAT3G10113-
AtGenExpressAT3G10113-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00341DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G10113.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G10113
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1156960.0AB115696.1 Arabidopsis thaliana EPR1 mRNA for MYB-related transcription factor EPR1, complete cds.
GenBankAY0639520.0AY063952.1 Arabidopsis thaliana unknown protein (At1g18330) mRNA, complete cds.
GenBankAY1140700.0AY114070.1 Arabidopsis thaliana unknown protein (At1g18330) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_683543.10.0myb family transcription factor
SwissprotF4J2J60.0RVE7L_ARATH; Protein REVEILLE 7-like
TrEMBLD7KGC90.0D7KGC9_ARALL; Early-phytochrome-responsive1
STRINGAT3G10113.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91742738
Representative plantOGRP12551549
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Kuno N, et al.
    The novel MYB protein EARLY-PHYTOCHROME-RESPONSIVE1 is a component of a slave circadian oscillator in Arabidopsis.
    Plant Cell, 2003. 15(10): p. 2476-88
    [PMID:14523250]
  3. Schneider A, et al.
    A transposon-based activation-tagging population in Arabidopsis thaliana (TAMARA) and its application in the identification of dominant developmental and metabolic mutations.
    FEBS Lett., 2005. 579(21): p. 4622-8
    [PMID:16087178]
  4. Rawat R, et al.
    REVEILLE1, a Myb-like transcription factor, integrates the circadian clock and auxin pathways.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(39): p. 16883-8
    [PMID:19805390]
  5. Owens SM,Harberson NA,Moore RC
    Asymmetric functional divergence of young, dispersed gene duplicates in Arabidopsis thaliana.
    J. Mol. Evol., 2013. 76(1-2): p. 13-27
    [PMID:23344714]